PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01032951001
Common NameVIT_14s0068g00770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family FAR1
Protein Properties Length: 409aa    MW: 46235.2 Da    PI: 6.4389
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01032951001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR184.61.6e-2696181288
               FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                        fYn+YAk vGFsvrk+  +ksk ng++++r+f+C keg+r+++k++  + +++r++trtgC a+++++++ +gk++v+++e +HnHe
  GSVIVT01032951001  96 FYNRYAKVVGFSVRKDFLNKSKVNGTVVSRRFTCFKEGYRRKDKRD-INVKKPRKQTRTGCLAQMTISRQPNGKYRVIHFEAKHNHE 181
                        9******************************************999.9999***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031018.7E-2496181IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MHSQFYLNIG AQGKIKTSSE RSMDPMSDKK LFSPYEEELD AKHLEVNCNL EQECDSPKGA  60
QFDLMQSRLS LENEDDIDEV PKVGMEFESE DDAYVFYNRY AKVVGFSVRK DFLNKSKVNG  120
TVVSRRFTCF KEGYRRKDKR DINVKKPRKQ TRTGCLAQMT ISRQPNGKYR VIHFEAKHNH  180
EGVGPHLVHM LPSQRRLAFS QAAEADLKVQ EHLKLASTSR YKDICLRAVK ISSRAAESRK  240
TFLFAVEKFD EVMQEVEKIL KMKPCEENQV SALSKQAANG EASDDIGNVE KEDVVCDVIQ  300
QNSMSGSLKR NEDMQTSAPN TDSSIPCPPP PYCLLQVPTP SPATEGLSSL EANPLMGYMY  360
QPPNLVMCQQ SNLSTFQSSN FYSSQHDFPS HIQLPQTMDC EDQHPMST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4886120.0AM488612.2 Vitis vinifera contig VV78X142737.6, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010660648.10.0PREDICTED: protein FAR-RED ELONGATED HYPOCOTYL 3-like
RefseqXP_010660647.10.0PREDICTED: protein FAR-RED ELONGATED HYPOCOTYL 3-like
TrEMBLD7SVE50.0D7SVE5_VITVI; Putative uncharacterized protein
STRINGVIT_14s0068g00770.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07500.15e-24FAR1 family protein